PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00021307-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family bZIP
Protein Properties Length: 470aa    MW: 52121.7 Da    PI: 6.2318
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00021307-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.93.2e-11263308550
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                       kr +r   NR +A+rsR RK+++i eLe+ v +L++e ++L  ++ 
  PSME_00021307-RA 263 KRVKRILANRQSAQRSRVRKLQYISELERSVNALQTEVSTLSPQVA 308
                       8999*********************************999876655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-13259323IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.956261313IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.4E-14263314No hitNo description
PfamPF001706.9E-10263310IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.34E-12263317No hitNo description
CDDcd147033.07E-25264314No hitNo description
PROSITE patternPS000360266281IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009555Biological Processpollen development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MAHHGAGDNS AANWGYTSSS SKLPQLPPKS PSFGIVGQDS NSNNMMYMGW PNMPFQGNSL  60
KHQRTPSVGY LSSHGHPSWI DDLLDSPSEN PAKKGPHHRR SASDSLAFLE APVNSAPIED  120
IAEEDEFDCR SAASIPSKGS QDFDRLDEEQ LMSMFADIEP FHKQQNQSNQ SGSNHHPAAP  180
STALDNRCSE RQTISENPST PSDHNSINET SMEEKVMTVS GQFKSEPEVQ SICKSEQPFQ  240
QAVKIEMPTS SSTMDLDTNI DPKRVKRILA NRQSAQRSRV RKLQYISELE RSVNALQTEV  300
STLSPQVAYL DHQRVLLNVD NGGLKQRIAA LAQDKLFKDA HCEALKKEVQ RLRQLYQEQQ  360
QQNMQKEVAT STTGSFDLQQ QQFGKLEHNS SPQMIDQKPN HVSDSSSNLM KSGSGISDHR  420
ENNAVNNHTS SGSQMLKGMM TSSCLMGDGN KCLEERMMGG MSPDYMVHNT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1060820.0BT106082.1 Picea glauca clone GQ02902_K11 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010260405.12e-84PREDICTED: basic leucine zipper 61-like
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.22e-58bZIP family protein